PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR11G04310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 329aa    MW: 36311.9 Da    PI: 8.6294
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR11G04310.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.84e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ ++k  G g+W++ ++  g+ R++k+c++rw +yl
  LPERR11G04310.1 14 KGAWTKEEDQRLIAYIKANGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding60.63.3e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++++lG++ W++Ia +++ gRt++++k++w+++
  LPERR11G04310.1  67 RGNFTEEEDELIIKLHELLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-23564IPR009057Homeodomain-like
PROSITE profilePS5129416.466961IPR017930Myb domain
SuperFamilySSF466892.84E-2913108IPR009057Homeodomain-like
SMARTSM007178.8E-131363IPR001005SANT/Myb domain
PfamPF002492.8E-141461IPR001005SANT/Myb domain
CDDcd001673.04E-101661No hitNo description
PROSITE profilePS5129429.5162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2865116IPR009057Homeodomain-like
SMARTSM007172.0E-1866114IPR001005SANT/Myb domain
PfamPF002492.0E-1767111IPR001005SANT/Myb domain
CDDcd001673.10E-1469112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010224Biological Processresponse to UV-B
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1903086Biological Processnegative regulation of sinapate ester biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIAYIK ANGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHELLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLNRG  120
VDPQTHRPLN AAADHHQQQL QASQPRFTAA APAGHHHDHF AILSNSPDAC SNSSDDEPSS  180
ATPPPPRHLG IDLNLSISLA PYQPEQENHP MKKEEDETAA MTASGAGNAT TTKVCLCLNR  240
LGLHGGEVCS CGRGGAPSMK ASTHMFRFIT PLGGASAIVI IMIYRSSGER EEIRRGNGEH  300
VGRRDGRDVN EGDKVPSRKG HGLRSFCNE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00479DAPTransfer from AT4G38620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0630271e-126AK063027.1 Oryza sativa Japonica Group cDNA clone:001-110-B12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615594.11e-153PREDICTED: myb-related protein 308
SwissprotQ9SZP12e-92MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A0D9XPP70.0A0A0D9XPP7_9ORYZ; Uncharacterized protein
STRINGBGIOSGA034924-PA1e-153(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.15e-92myb domain protein 4